Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) automatically mapped to Pfam PF02935 |
Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries) |
Domain d7cohl_: 7coh L: [401885] Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohz_ automated match to d1v54l_ complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn |
PDB Entry: 7coh (more details), 1.3 Å
SCOPe Domain Sequences for d7cohl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cohl_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]} yeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllk
Timeline for d7cohl_:
View in 3D Domains from other chains: (mouse over for more information) d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_ |