SCOPe 2.07: Domain d7cohs_: 7coh S:

Lineage for d7cohs_ (7coh S:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)

8. Domain d7cohs_: 7coh S: [401865]
   Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
   automated match to d1v54f_
   complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohs_

PDB Entry: 7coh, 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d7cohs_:

Sequence; same for both SEQRES and ATOM records:

>d7cohs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic
eednstviwfwlhkgeaqrcpscgthyklvp

Timeline for d7cohs_:

• d7cohs_ is new in SCOPe 2.07-stable
  
• d7cohs_ appears in the current release, SCOPe 2.08