Lineage for d7cohc_ (7coh C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027151Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 3027152Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 3027153Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 3027166Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 3027167Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)
  8. 3027168Domain d7cohc_: 7coh C: [401833]
    Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
    automated match to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohc_

PDB Entry: 7coh (more details), 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7cohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cohc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
fvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d7cohc_:

Click to download the PDB-style file with coordinates for d7cohc_.
(The format of our PDB-style files is described here.)

Timeline for d7cohc_: