SCOPe 2.08: Domain d7by8d2: 7by8 D:147-311

Lineage for d7by8d2 (7by8 D:147-311)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [401758] (3 PDB entries)

8. Domain d7by8d2: 7by8 D:147-311 [401810]
   Other proteins in same PDB: d7by8a1, d7by8b1, d7by8c1, d7by8d1
   automated match to d3tl2a2

Details for d7by8d2

PDB Entry: 7by8, 1.95 Å

PDB Description: malate dehydrogenase from geobacillus stearothermophilus (gs-mdh)

PDB Compounds: (D:) malate dehydrogenase

SCOPe Domain Sequences for d7by8d2:

Sequence; same for both SEQRES and ATOM records:

>d7by8d2 d.162.1.0 (D:147-311) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qsgvldtarfrtfvaeelnisvkdvtgfvlgghgddmvplvrysyaggipleklipkdrl
daivertrkgggeivnllgngsayyapaaslvemveailkdqrrilpaiaylegeygyeg
iylgvptilggngiekvielelteeekaalaksvesvknvmrmle

Timeline for d7by8d2:

• d7by8d2 first appeared in SCOPe 2.07