SCOPe 2.08: Domain d7ackb1: 7ack B:175-309

Lineage for d7ackb1 (7ack B:175-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d7ackb1: 7ack B:175-309 [401731]
   Other proteins in same PDB: d7acka1, d7acka2, d7ackc1, d7ackc2
   automated match to d1h1pb1
   complexed with edo, na, no3, r7b

Details for d7ackb1

PDB Entry: 7ack, 1.8 Å

PDB Description: cdk2/cyclin a2 in complex with an imidazo[1,2-c]pyrimidin-5-one inhibitor

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d7ackb1:

Sequence; same for both SEQRES and ATOM records:

>d7ackb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d7ackb1:

• d7ackb1 first appeared in SCOPe 2.07