Lineage for d3grs_3 (3grs 364-478)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34166Protein Glutathione reductase [55426] (2 species)
  7. 34176Species Human (Homo sapiens) [TaxId:9606] [55427] (16 PDB entries)
  8. 34177Domain d3grs_3: 3grs 364-478 [40152]
    Other proteins in same PDB: d3grs_1, d3grs_2

Details for d3grs_3

PDB Entry: 3grs (more details), 1.54 Å

PDB Description: refined structure of glutathione reductase at 1.54 angstroms resolution

SCOP Domain Sequences for d3grs_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grs_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOP Domain Coordinates for d3grs_3:

Click to download the PDB-style file with coordinates for d3grs_3.
(The format of our PDB-style files is described here.)

Timeline for d3grs_3: