SCOPe 2.08: Domain d6yecb_: 6yec B:

Lineage for d6yecb_ (6yec B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [322769] (10 PDB entries)

8. Domain d6yecb_: 6yec B: [401353]
   automated match to d3ttma_
   complexed with cl, edo, gol, peg, pg4, pge, so4, spm

Details for d6yecb_

PDB Entry: 6yec, 2.09 Å

PDB Description: e.coli's putrescine receptor potf complexed with spermine

PDB Compounds: (B:) Putrescine-binding periplasmic protein

SCOPe Domain Sequences for d6yecb_:

Sequence; same for both SEQRES and ATOM records:

>d6yecb_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

Timeline for d6yecb_:

• d6yecb_ first appeared in SCOPe 2.07