Lineage for d6ye0b_ (6ye0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914767Species Escherichia coli [TaxId:83333] [322769] (10 PDB entries)
  8. 2914777Domain d6ye0b_: 6ye0 B: [401307]
    automated match to d3ttma_
    complexed with jfn, ont, onw, put

Details for d6ye0b_

PDB Entry: 6ye0 (more details), 1.63 Å

PDB Description: e.coli's putrescine receptor potf complexed with putrescine
PDB Compounds: (B:) Putrescine-binding periplasmic protein

SCOPe Domain Sequences for d6ye0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ye0b_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOPe Domain Coordinates for d6ye0b_:

Click to download the PDB-style file with coordinates for d6ye0b_.
(The format of our PDB-style files is described here.)

Timeline for d6ye0b_: