Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d6yaua_: 6yau A: [401302] automated match to d4gj0a_ complexed with ca, ojb |
PDB Entry: 6yau (more details), 1.4 Å
SCOPe Domain Sequences for d6yaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yaua_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwm glhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrp yrwvcetel
Timeline for d6yaua_: