SCOPe 2.08: Domain d6xx0d_: 6xx0 D:

Lineage for d6xx0d_ (6xx0 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d6xx0d_: 6xx0 D: [401154]
   automated match to d5hptb_

Details for d6xx0d_

PDB Entry: 6xx0, 2.6 Å

PDB Description: crystal structure of nemo in complex with ubv-lin

PDB Compounds: (D:) Ubv-LIN

SCOPe Domain Sequences for d6xx0d_:

Sequence; same for both SEQRES and ATOM records:

>d6xx0d_ d.15.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpmqinvktltgttiglevepsdtienvkakiqdkegippdqqilffsgmqledgrtlsd
yniqkesrlylvfslr

Timeline for d6xx0d_:

• d6xx0d_ first appeared in SCOPe 2.07