Lineage for d6xrua2 (6xru A:131-306)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439025Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2439055Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)
  8. 3101084Domain d6xrua2: 6xru A:131-306 [401146]
    Other proteins in same PDB: d6xrua1, d6xrua3, d6xrub1, d6xrub2
    automated match to d1euda2
    complexed with dca, edo, gol, mg, po4, sin

Details for d6xrua2

PDB Entry: 6xru (more details), 1.4 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with desulfo-coenzyme a, magnesium ions and succinates
PDB Compounds: (A:) Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6xrua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xrua2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d6xrua2:

Click to download the PDB-style file with coordinates for d6xrua2.
(The format of our PDB-style files is described here.)

Timeline for d6xrua2:

  • d6xrua2 is new in SCOPe 2.07-stable