Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries) |
Domain d6xrua1: 6xru A:2-130 [401145] Other proteins in same PDB: d6xrua2, d6xrua3, d6xrub1, d6xrub2 automated match to d1euda1 complexed with dca, edo, gol, mg, po4, sin |
PDB Entry: 6xru (more details), 1.4 Å
SCOPe Domain Sequences for d6xrua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xrua1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr qgktrligp
Timeline for d6xrua1: