Lineage for d6xrua1 (6xru A:2-130)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430117Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2430135Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2430165Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries)
  8. 3101083Domain d6xrua1: 6xru A:2-130 [401145]
    Other proteins in same PDB: d6xrua2, d6xrua3, d6xrub1, d6xrub2
    automated match to d1euda1
    complexed with dca, edo, gol, mg, po4, sin

Details for d6xrua1

PDB Entry: 6xru (more details), 1.4 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with desulfo-coenzyme a, magnesium ions and succinates
PDB Compounds: (A:) Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d6xrua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xrua1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

SCOPe Domain Coordinates for d6xrua1:

Click to download the PDB-style file with coordinates for d6xrua1.
(The format of our PDB-style files is described here.)

Timeline for d6xrua1:

  • d6xrua1 is new in SCOPe 2.07-stable