Lineage for d6wgua_ (6wgu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705281Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2705282Protein automated matches [190652] (6 species)
    not a true protein
  7. 2705319Species Mycobacterium tuberculosis [TaxId:1773] [187731] (5 PDB entries)
  8. 2705321Domain d6wgua_: 6wgu A: [400974]
    automated match to d3gaha_
    complexed with so4

Details for d6wgua_

PDB Entry: 6wgu (more details), 1.65 Å

PDB Description: mycobacterium tuberculosis pduo-type atp:cobalamin adenosyltransferase
PDB Compounds: (A:) Corrinoid adenosyltransferase

SCOPe Domain Sequences for d6wgua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wgua_ a.25.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdarlvayadcdeanaaigaalalghpdtqitdvlrqiqndlfdagadlstpivenpkhp
plriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvartvvrraersawaavd
ahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpg

SCOPe Domain Coordinates for d6wgua_:

Click to download the PDB-style file with coordinates for d6wgua_.
(The format of our PDB-style files is described here.)

Timeline for d6wgua_: