SCOPe 2.08: Domain d6w12a1: 6w12 A:181-308

Lineage for d6w12a1 (6w12 A:181-308)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d6w12a1: 6w12 A:181-308 [400870]
   Other proteins in same PDB: d6w12a2
   automated match to d2bpdb_
   complexed with a2g, ca, cl, ser, zn

Details for d6w12a1

PDB Entry: 6w12, 2 Å

PDB Description: crystal structure of the carbohydrate recognition domain of the human macrophage galactose c-type lectin bound to the tumor-associated tn antigen

PDB Compounds: (A:) C-type lectin domain family 10 member A

SCOPe Domain Sequences for d6w12a1:

Sequence; same for both SEQRES and ATOM records:

>d6w12a1 d.169.1.0 (A:181-308) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpvnwvehqdscywfshsgmswaeaekycqlknahlvvinsreeqnfvqkylgsaytwmg
lsdpegawkwvdgtdyatgfqnwkpgqpddwqghglgggedcahfhpdgrwnddvcqrpy
hwvceagl

Timeline for d6w12a1:

• d6w12a1 first appeared in SCOPe 2.07