SCOPe 2.08: Domain d6tv0d2: 6tv0 D:87-156

Lineage for d6tv0d2 (6tv0 D:87-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.0: automated matches [271343] (1 protein)
   not a true family

6. Protein automated matches [271344] (3 species)
   not a true protein

7. Species Serratia sp. [TaxId:616] [400572] (1 PDB entry)

8. Domain d6tv0d2: 6tv0 D:87-156 [400620]
   Other proteins in same PDB: d6tv0a1, d6tv0b1, d6tv0c1, d6tv0d1, d6tv0e1, d6tv0f1, d6tv0g1, d6tv0h1, d6tv0i1, d6tv0j1
   automated match to d6b6ma2
   complexed with gol, oxd

Details for d6tv0d2

PDB Entry: 6tv0, 1.96 Å

PDB Description: serratia spp. cyanase hydratase

PDB Compounds: (D:) cyanate hydratase

SCOPe Domain Sequences for d6tv0d2:

Sequence; same for both SEQRES and ATOM records:

>d6tv0d2 d.72.1.0 (D:87-156) automated matches {Serratia sp. [TaxId: 616]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

Timeline for d6tv0d2:

• d6tv0d2 first appeared in SCOPe 2.07