Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily) intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta |
Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) automatically mapped to Pfam PF02560 |
Family d.72.1.0: automated matches [271343] (1 protein) not a true family |
Protein automated matches [271344] (3 species) not a true protein |
Species Serratia sp. [TaxId:616] [400572] (1 PDB entry) |
Domain d6tv0a2: 6tv0 A:87-156 [400580] Other proteins in same PDB: d6tv0a1, d6tv0b1, d6tv0c1, d6tv0d1, d6tv0e1, d6tv0f1, d6tv0g1, d6tv0h1, d6tv0i1, d6tv0j1 automated match to d6b6ma2 complexed with gol, oxd |
PDB Entry: 6tv0 (more details), 1.96 Å
SCOPe Domain Sequences for d6tv0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tv0a2 d.72.1.0 (A:87-156) automated matches {Serratia sp. [TaxId: 616]} gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl dgkylptkpf
Timeline for d6tv0a2: