Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) |
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) |
Protein MS2 virus coat protein [55407] (1 species) |
Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries) |
Domain d1e7xc_: 1e7x C: [40038] protein/RNA complex; complexed with pyo; mutant |
PDB Entry: 1e7x (more details), 2.38 Å
SCOP Domain Sequences for d1e7xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7xc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d1e7xc_: