Lineage for d1e7xc_ (1e7x C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607033Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 607034Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 607035Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 607084Protein MS2 virus coat protein [55407] (1 species)
  7. 607085Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)
  8. 607091Domain d1e7xc_: 1e7x C: [40038]
    protein/RNA complex; complexed with pyo; mutant

Details for d1e7xc_

PDB Entry: 1e7x (more details), 2.38 Å

PDB Description: ms2-rna hairpin (2one-5) complex

SCOP Domain Sequences for d1e7xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7xc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1e7xc_:

Click to download the PDB-style file with coordinates for d1e7xc_.
(The format of our PDB-style files is described here.)

Timeline for d1e7xc_: