Lineage for d1dlxa_ (1dlx A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135259Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 135284Superfamily d.82.2: Frataxin-like [55387] (1 family) (S)
  5. 135285Family d.82.2.1: Frataxin-like [55388] (2 proteins)
  6. 135286Protein C-terminal domain of frataxin [55389] (1 species)
  7. 135287Species Human (Homo sapiens) [TaxId:9606] [55390] (2 PDB entries)
  8. 135289Domain d1dlxa_: 1dlx A: [40022]

Details for d1dlxa_

PDB Entry: 1dlx (more details)

PDB Description: the solution structure of the the c-terminal domain of frataxin, the protein responsible for friedreich ataxia

SCOP Domain Sequences for d1dlxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlxa_ d.82.2.1 (A:) C-terminal domain of frataxin {Human (Homo sapiens)}
dettyerlaeetldslaeffedladkpytfedydvsfgsgvltvklggdlgtyvinkqtp
nkqiwlsspssgpkrydwtgknwvyshdgvslhellaaeltkalktkldlsslaysgkda

SCOP Domain Coordinates for d1dlxa_:

Click to download the PDB-style file with coordinates for d1dlxa_.
(The format of our PDB-style files is described here.)

Timeline for d1dlxa_: