Lineage for d1d6ua4 (1d6u A:7-90)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33949Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)
  4. 33950Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 33951Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 33952Protein Copper amine oxidase, domain N [55385] (1 species)
  7. 33953Species Escherichia coli [TaxId:562] [55386] (9 PDB entries)
  8. 33966Domain d1d6ua4: 1d6u A:7-90 [40015]
    Other proteins in same PDB: d1d6ua1, d1d6ua2, d1d6ua3, d1d6ub1, d1d6ub2, d1d6ub3

Details for d1d6ua4

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine

SCOP Domain Sequences for d1d6ua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ua4 d.82.1.1 (A:7-90) Copper amine oxidase, domain N {Escherichia coli}
mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
kawvsdtfindvfqsgldqtfqve

SCOP Domain Coordinates for d1d6ua4:

Click to download the PDB-style file with coordinates for d1d6ua4.
(The format of our PDB-style files is described here.)

Timeline for d1d6ua4: