Lineage for d7nd9l2 (7nd9 L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751393Domain d7nd9l2: 7nd9 L:108-214 [400125]
    Other proteins in same PDB: d7nd9h_, d7nd9l1
    automated match to d1dn0a2
    complexed with nag

Details for d7nd9l2

PDB Entry: 7nd9 (more details), 2.8 Å

PDB Description: em structure of sars-cov-2 spike glycoprotein (one rbd up) in complex with covox-253h55l fab
PDB Compounds: (L:) COVOX-253H55L Fab light chain

SCOPe Domain Sequences for d7nd9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nd9l2 b.1.1.2 (L:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d7nd9l2:

Click to download the PDB-style file with coordinates for d7nd9l2.
(The format of our PDB-style files is described here.)

Timeline for d7nd9l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7nd9l1
View in 3D
Domains from other chains:
(mouse over for more information)
d7nd9h_