SCOP 1.57: Domain d1spub4: 1spu B:6-90

Lineage for d1spub4 (1spu B:6-90)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (2 superfamilies)

4. Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family)

5. Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)

6. Protein Copper amine oxidase, domain N [55385] (1 species)

7. Species Escherichia coli [TaxId:562] [55386] (9 PDB entries)

8. Domain d1spub4: 1spu B:6-90 [40012]
   Other proteins in same PDB: d1spua1, d1spua2, d1spua3, d1spub1, d1spub2, d1spub3

Details for d1spub4

PDB Entry: 1spu, 2 Å

PDB Description: structure of oxidoreductase

SCOP Domain Sequences for d1spub4:

Sequence; same for both SEQRES and ATOM records:

>d1spub4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

Timeline for d1spub4:

• d1spub4 first appeared (with stable ids) in SCOP 1.55
  
• d1spub4 appears in SCOP 1.59
  
• d1spub4 appears in the current release, SCOPe 2.08