Lineage for d7nqub1 (7nqu B:33-218)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493223Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)
  8. 2493240Domain d7nqub1: 7nqu B:33-218 [400088]
    automated match to d3fe1a1
    complexed with an2, cl, gol, hr5, pg4, po4

Details for d7nqub1

PDB Entry: 7nqu (more details), 2.13 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with z396380540
PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d7nqub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nqub1 c.55.1.0 (B:33-218) automated matches {Plasmodium falciparum [TaxId: 36329]}
evaigidlgttyscvgicrngvvdiiandqgnrttpsyvaftdterligdaaknqasrnp
entvfdakrligrkfsettvqsdmkhwpftvkggsdgkpmievsyqgekktfhpeeissm
vlkkmkevaetylgkpvknavitvpayfndsqrqatkdagaiaglnvlriineptaaaia
ygldkk

SCOPe Domain Coordinates for d7nqub1:

Click to download the PDB-style file with coordinates for d7nqub1.
(The format of our PDB-style files is described here.)

Timeline for d7nqub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7nqub2