SCOPe 2.07: Domain d7nqxb2: 7nqx B:221-414

Lineage for d7nqxb2 (7nqx B:221-414)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225582] (27 PDB entries)

8. Domain d7nqxb2: 7nqx B:221-414 [400076]
   automated match to d3fe1a2
   complexed with an2, cl, gol, pg4, po4, pyz

Details for d7nqxb2

PDB Entry: 7nqx, 2.36 Å

PDB Description: plasmodium falciparum hsp70-x chaperone nucleotide binding domain in complex with ncl-00023818

PDB Compounds: (B:) Heat shock protein 70

SCOPe Domain Sequences for d7nqxb2:

Sequence, based on SEQRES records:

>d7nqxb2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkkng
gkdvsknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdq
frntlipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeav
aygaavqaailsgd

Sequence, based on observed residues (ATOM records):

>d7nqxb2 c.55.1.0 (B:221-414) automated matches {Plasmodium falciparum [TaxId: 36329]}
geqnilifdlgggtfdvslltledgifevkatsgdthlggedfdnklvnfcvqdfkkknv
sknskslrrlrtqcekakrvlsssaqatievdslfdgidynvnitrakfeelcmdqfrnt
lipvekvlkdakmdksqvheivlvggstripkiqqlikdffngkepckainpdeavayga
avqaailsgd

Timeline for d7nqxb2:

• d7nqxb2 is new in SCOPe 2.07-stable
  
• d7nqxb2 does not appear in SCOPe 2.08