Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (5 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries) |
Domain d7nehe1: 7neh E:333-527 [400057] Other proteins in same PDB: d7nehe2, d7nehh_, d7nehl1, d7nehl2 automated match to d2dd8s1 complexed with cl, edo, no3, peg, so4 |
PDB Entry: 7neh (more details), 1.77 Å
SCOPe Domain Sequences for d7nehe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nehe1 d.318.1.1 (E:333-527) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf tnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyl yrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvv lsfellhapatvcgk
Timeline for d7nehe1: