SCOPe 2.08: Domain d6m2ya2: 6m2y A:182-341

Lineage for d6m2ya2 (6m2y A:182-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Benzoylformate decarboxylase [52482] (1 species)

7. Species Pseudomonas putida [TaxId:303] [52483] (43 PDB entries)
   Uniprot P20906

8. Domain d6m2ya2: 6m2y A:182-341 [399990]
   Other proteins in same PDB: d6m2ya1, d6m2ya3
   automated match to d1q6za1
   complexed with mg, tpp

Details for d6m2ya2

PDB Entry: 6m2y, 2.1 Å

PDB Description: crystal structure of a formolase, bfd variant m6 from pseudomonas putida

PDB Compounds: (A:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d6m2ya2:

Sequence; same for both SEQRES and ATOM records:

>d6m2ya2 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryyqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d6m2ya2:

• d6m2ya2 first appeared in SCOPe 2.07