SCOPe 2.08: Domain d7lopy2: 7lop Y:108-215

Lineage for d7lopy2 (7lop Y:108-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7lopy2: 7lop Y:108-215 [399854]
   Other proteins in same PDB: d7lopa_, d7lopz_
   automated match to d1dqdl2
   complexed with nag

Details for d7lopy2

PDB Entry: 7lop, 2.25 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain in complex with antibodies cv05-163 and cr3022

PDB Compounds: (Y:) CV05-163 Fab light chain

SCOPe Domain Sequences for d7lopy2:

Sequence; same for both SEQRES and ATOM records:

>d7lopy2 b.1.1.0 (Y:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgecs

Timeline for d7lopy2:

• d7lopy2 first appeared in SCOPe 2.07