SCOPe 2.07: Domain d6lwta1: 6lwt A:40-125

Lineage for d6lwta1 (6lwt A:40-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:46170] [399787] (1 PDB entry)

8. Domain d6lwta1: 6lwt A:40-125 [399788]
   Other proteins in same PDB: d6lwta2, d6lwta3, d6lwtb2, d6lwtb3
   automated match to d3r2ta1

Details for d6lwta1

PDB Entry: 6lwt, 1.9 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 10

PDB Compounds: (A:) Superantigen-like protein SSL10

SCOPe Domain Sequences for d6lwta1:

Sequence; same for both SEQRES and ATOM records:

>d6lwta1 b.40.2.0 (A:40-125) automated matches {Staphylococcus aureus [TaxId: 46170]}
hdkealyryytgktmemknisalkhgknnlrfkfrgikiqvllpgndkskfqqrsyegld
vffvqekrdkhdifytvggviqnnkt

Timeline for d6lwta1:

• d6lwta1 is new in SCOPe 2.07-stable
  
• d6lwta1 appears in the current release, SCOPe 2.08