Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein automated matches [319939] (2 species) not a true protein |
Species Janthinobacterium sp. [TaxId:213804] [399623] (9 PDB entries) |
Domain d6llhb2: 6llh B:143-384 [399711] Other proteins in same PDB: d6llha1, d6llha3, d6llhb1, d6llhb3, d6llhc1, d6llhc3 automated match to d2de6a2 complexed with act, bpy, edo, fe2, fes, gol, peg, pge |
PDB Entry: 6llh (more details), 1.99 Å
SCOPe Domain Sequences for d6llhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6llhb2 d.129.3.3 (B:143-384) automated matches {Janthinobacterium sp. [TaxId: 213804]} pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv sg
Timeline for d6llhb2: