Lineage for d1dih_2 (1dih 131-240)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (2 proteins) 
Protein Dihydrodipicolinate reductase [55371] (1 species) Species Escherichia coli [TaxId:562] [55372] (5 PDB entries) 
Domain d1dih_2: 1dih 131-240 [39971]
Other proteins in same PDB: d1dih_1
Details for d1dih_2
PDB Entry: 1dih (more details), 2.2 Å
PDB Description: three-dimensional structure of e. coli dihydrodipicolinate reductase
SCOP Domain Sequences for d1dih_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dih_2 d.81.1.3 (131-240) Dihydrodipicolinate reductase {Escherichia coli}
vgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahaldkdlkdca
vysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
SCOP Domain Coordinates for d1dih_2:
Click to download the PDB-style file with coordinates for d1dih_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dih_2:
- d1dih_2 appears in SCOP 1.57
- d1dih_2 appears in the current release, SCOPe 2.08, called d1diha2
View in 3D
