Lineage for d1dapb2 (1dap B:119-268)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 194013Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 194019Protein Diaminopimelic acid dehydrogenase (DAPDH) [55369] (1 species)
  7. 194020Species Corynebacterium glutamicum [TaxId:1718] [55370] (4 PDB entries)
  8. 194027Domain d1dapb2: 1dap B:119-268 [39969]
    Other proteins in same PDB: d1dapa1, d1dapb1

Details for d1dapb2

PDB Entry: 1dap (more details), 2.2 Å

PDB Description: c. glutamicum dap dehydrogenase in complex with nadp+

SCOP Domain Sequences for d1dapb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dapb2 d.81.1.3 (B:119-268) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum}
wdpgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalek
arrgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdse
htgmphgghvittgdtggfnhtveyilkld

SCOP Domain Coordinates for d1dapb2:

Click to download the PDB-style file with coordinates for d1dapb2.
(The format of our PDB-style files is described here.)

Timeline for d1dapb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dapb1