Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d6lema2: 6lem A:182-273 [399626] Other proteins in same PDB: d6lema1, d6lema3, d6lema4, d6lemb1, d6lemb3 automated match to d3lpfa2 complexed with e9o |
PDB Entry: 6lem (more details), 3.19 Å
SCOPe Domain Sequences for d6lema2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lema2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d6lema2: