Lineage for d6lema2 (6lem A:182-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763227Domain d6lema2: 6lem A:182-273 [399626]
    Other proteins in same PDB: d6lema1, d6lema3, d6lema4, d6lemb1, d6lemb3
    automated match to d3lpfa2
    complexed with e9o

Details for d6lema2

PDB Entry: 6lem (more details), 3.19 Å

PDB Description: structure of e. coli beta-glucuronidase complex with c6-nonyl uronic isofagomine
PDB Compounds: (A:) Beta-D-glucuronidase

SCOPe Domain Sequences for d6lema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lema2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d6lema2:

Click to download the PDB-style file with coordinates for d6lema2.
(The format of our PDB-style files is described here.)

Timeline for d6lema2: