SCOPe 2.08: Domain d1e5qf2: 1e5q F:125-391

Lineage for d1e5qf2 (1e5q F:125-391)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)

6. Protein Saccharopine reductase [55366] (1 species)
   contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)

8. Domain d1e5qf2: 1e5q F:125-391 [39960]
   Other proteins in same PDB: d1e5qa1, d1e5qb1, d1e5qc1, d1e5qd1, d1e5qe1, d1e5qf1, d1e5qg1, d1e5qh1
   complexed with ndp, shr

Details for d1e5qf2

PDB Entry: 1e5q, 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine

PDB Compounds: (F:) Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]

SCOPe Domain Sequences for d1e5qf2:

Sequence; same for both SEQRES and ATOM records:

>d1e5qf2 d.81.1.2 (F:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

Timeline for d1e5qf2:

• d1e5qf2 first appeared (with stable ids) in SCOP 1.55
  
• d1e5qf2 appears in SCOPe 2.07