Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) |
Protein Saccharopine reductase [55366] (1 species) contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures |
Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries) |
Domain d1e5qd2: 1e5q D:125-391 [39958] Other proteins in same PDB: d1e5qa1, d1e5qb1, d1e5qc1, d1e5qd1, d1e5qe1, d1e5qf1, d1e5qg1, d1e5qh1 |
PDB Entry: 1e5q (more details), 2.1 Å
SCOP Domain Sequences for d1e5qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5qd2 d.81.1.2 (D:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)} ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf eienkdgsretrtsslceygapigsgg
Timeline for d1e5qd2: