Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) |
Protein Saccharopine reductase [55366] (1 species) contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures |
Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries) |
Domain d1ff9a2: 1ff9 A:125-391 [39954] Other proteins in same PDB: d1ff9a1 complexed with so4 |
PDB Entry: 1ff9 (more details), 2 Å
SCOPe Domain Sequences for d1ff9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ff9a2 d.81.1.2 (A:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]} ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf eienkdgsretrtsslceygapigsgg
Timeline for d1ff9a2: