SCOPe 2.06: Domain d1ff9a2: 1ff9 A:125-391

Lineage for d1ff9a2 (1ff9 A:125-391)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)

6. Protein Saccharopine reductase [55366] (1 species)
   contains an alpha-helical subdomain inserted in the common fold and other additional secondary structures

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [55367] (3 PDB entries)

8. Domain d1ff9a2: 1ff9 A:125-391 [39954]
   Other proteins in same PDB: d1ff9a1
   complexed with so4

Details for d1ff9a2

PDB Entry: 1ff9, 2 Å

PDB Description: apo saccharopine reductase

PDB Compounds: (A:) saccharopine reductase

SCOPe Domain Sequences for d1ff9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ff9a2 d.81.1.2 (A:125-391) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvllalr
naasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadnivrg
tlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstivsna
tfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlqhkf
eienkdgsretrtsslceygapigsgg

Timeline for d1ff9a2:

• d1ff9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ff9a2 appears in SCOPe 2.05
  
• d1ff9a2 appears in SCOPe 2.07
  
• d1ff9a2 appears in the current release, SCOPe 2.08