Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins) |
Protein Homoserine dehydrogenase [55364] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (4 PDB entries) Uniprot P31116 |
Domain d1ebuc2: 1ebu C:151-340 [39952] Other proteins in same PDB: d1ebua1, d1ebub1, d1ebuc1, d1ebud1 complexed with hse, na, nda |
PDB Entry: 1ebu (more details), 2.6 Å
SCOPe Domain Sequences for d1ebuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebuc2 d.81.1.2 (C:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn pvviqgagag
Timeline for d1ebuc2: