SCOPe 2.06: Domain d1ebuc2: 1ebu C:151-340

Lineage for d1ebuc2 (1ebu C:151-340)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
Protein Homoserine dehydrogenase [55364] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (4 PDB entries)
Uniprot P31116
Domain d1ebuc2: 1ebu C:151-340 [39952]
Other proteins in same PDB: d1ebua1, d1ebub1, d1ebuc1, d1ebud1
complexed with hse, na, nda

Details for d1ebuc2

PDB Entry: 1ebu (more details), 2.6 Å

PDB Description: homoserine dehydrogenase complex with nad analogue and l-homoserine

PDB Compounds: (C:) homoserine dehydrogenase

SCOPe Domain Sequences for d1ebuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebuc2 d.81.1.2 (C:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd
prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd
ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn
pvviqgagag

SCOPe Domain Coordinates for d1ebuc2:

Click to download the PDB-style file with coordinates for d1ebuc2.
(The format of our PDB-style files is described here.)

Timeline for d1ebuc2: