Lineage for d1brmc2 (1brm C:134-354)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33778Protein Aspartate beta-semialdehyde dehydrogenase [55361] (1 species)
  7. 33779Species Escherichia coli [TaxId:562] [55362] (1 PDB entry)
  8. 33782Domain d1brmc2: 1brm C:134-354 [39947]
    Other proteins in same PDB: d1brma1, d1brmb1, d1brmc1

Details for d1brmc2

PDB Entry: 1brm (more details), 2.5 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli

SCOP Domain Sequences for d1brmc2:

Sequence, based on SEQRES records: (download)

>d1brmc2 d.81.1.1 (C:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

Sequence, based on observed residues (ATOM records): (download)

>d1brmc2 d.81.1.1 (C:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkeewkgqaetnkilntssvipv
dglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitmreltpaav
tgtlttpvgrlrklnmgpeflsaftvgdqllwg

SCOP Domain Coordinates for d1brmc2:

Click to download the PDB-style file with coordinates for d1brmc2.
(The format of our PDB-style files is described here.)

Timeline for d1brmc2: