Lineage for d1dssg2 (1dss G:149-312)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33845Species Lobster (Palinurus versicolor) [55359] (3 PDB entries)
  8. 33846Domain d1dssg2: 1dss G:149-312 [39937]
    Other proteins in same PDB: d1dssg1, d1dssr1

Details for d1dssg2

PDB Entry: 1dss (more details), 1.88 Å

PDB Description: structure of active-site carboxymethylated d-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor

SCOP Domain Sequences for d1dssg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dssg2 d.81.1.1 (G:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1dssg2:

Click to download the PDB-style file with coordinates for d1dssg2.
(The format of our PDB-style files is described here.)

Timeline for d1dssg2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dssg1