Lineage for d7krea2 (7kre A:430-538)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887379Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)
  8. 2887402Domain d7krea2: 7kre A:430-538 [399350]
    Other proteins in same PDB: d7krea1, d7kreb_
    automated match to d1dloa1
    complexed with x2v

Details for d7krea2

PDB Entry: 7kre (more details), 2.73 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 4- ((6-cyanonaphthalen-1-yl)oxy)-3-(2-(2,4-dioxo-3,4-dihydropyrimidin- 1(2h)-yl)ethoxy)phenyl sulfurofluoridate (jlj704)
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d7krea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7krea2 c.55.3.0 (A:430-538) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa

SCOPe Domain Coordinates for d7krea2:

Click to download the PDB-style file with coordinates for d7krea2.
(The format of our PDB-style files is described here.)

Timeline for d7krea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7krea1
View in 3D
Domains from other chains:
(mouse over for more information)
d7kreb_