SCOPe 2.08: Domain d7kn5e_: 7kn5 E:

Lineage for d7kn5e_ (7kn5 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d7kn5e_: 7kn5 E: [399325]
   Other proteins in same PDB: d7kn5a_, d7kn5b_
   automated match to d5hggs_
   complexed with edo, nag

Details for d7kn5e_

PDB Entry: 7kn5, 1.87 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain complexed with nanobodies vhh e and u

PDB Compounds: (E:) vhh u

SCOPe Domain Sequences for d7kn5e_:

Sequence, based on SEQRES records:

>d7kn5e_ b.1.1.1 (E:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvesggglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggsthfa
dsvkgrftisrdnakntvylqmnslipedtavyycaaqsgsyywcgsdwheyeywgqgtq
vtv

Sequence, based on observed residues (ATOM records):

>d7kn5e_ b.1.1.1 (E:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlvesgglvqpggslrlscaasgftldyyaigwfrqapgkeregvscisssggsthfad
svkrftisrdnakntvylqmnslipedtavyycaaqsgsyywcgsdwheyeywgqgtqvt
v

Timeline for d7kn5e_:

• d7kn5e_ first appeared in SCOPe 2.07