SCOPe 2.08: Domain d7kjhb1: 7kjh B:6-118

Lineage for d7kjhb1 (7kjh B:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d7kjhb1: 7kjh B:6-118 [399282]
   Other proteins in same PDB: d7kjha2, d7kjha3, d7kjhb2, d7kjhb3
   automated match to d5da4a_
   complexed with flc, nag

Details for d7kjhb1

PDB Entry: 7kjh, 2 Å

PDB Description: plasmodium falciparum protein pf12p bound to nanobody b9

PDB Compounds: (B:) Nanobody B9

SCOPe Domain Sequences for d7kjhb1:

Sequence; same for both SEQRES and ATOM records:

>d7kjhb1 b.1.1.1 (B:6-118) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlsctasgrtfsntvmgwfrqapgkereflahilwsgglayyadsvk
grftisrdnaknivylqmnslkpedtavyycaardfgfgnnydywgqgtqvtv

Timeline for d7kjhb1:

• d7kjhb1 first appeared in SCOPe 2.07