Lineage for d1gypd2 (1gyp D:166-334)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81620Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 81621Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 81622Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 81628Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 81673Species Leishmania mexicana [TaxId:5665] [55357] (3 PDB entries)
  8. 81677Domain d1gypd2: 1gyp D:166-334 [39922]
    Other proteins in same PDB: d1gypa1, d1gypb1, d1gypc1, d1gypd1

Details for d1gypd2

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

SCOP Domain Sequences for d1gypd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypd2 d.81.1.1 (D:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gypd2:

Click to download the PDB-style file with coordinates for d1gypd2.
(The format of our PDB-style files is described here.)

Timeline for d1gypd2: