Lineage for d1gypa2 (1gyp A:166-334)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659010Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1659101Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1659320Species Trypanosome (Leishmania mexicana) [TaxId:5665] [55357] (5 PDB entries)
  8. 1659327Domain d1gypa2: 1gyp A:166-334 [39919]
    Other proteins in same PDB: d1gypa1, d1gypb1, d1gypc1, d1gypd1
    complexed with nad, po4

Details for d1gypa2

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypa2 d.81.1.1 (A:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOPe Domain Coordinates for d1gypa2:

Click to download the PDB-style file with coordinates for d1gypa2.
(The format of our PDB-style files is described here.)

Timeline for d1gypa2: