SCOP 1.65: Domain d1gypa2: 1gyp A:166-334

Lineage for d1gypa2 (1gyp A:166-334)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (3 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)
Domain d1gypa2: 1gyp A:166-334 [39919]
Other proteins in same PDB: d1gypa1, d1gypb1, d1gypc1, d1gypd1

Details for d1gypa2

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

SCOP Domain Sequences for d1gypa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypa2 d.81.1.1 (A:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gypa2:

Click to download the PDB-style file with coordinates for d1gypa2.
(The format of our PDB-style files is described here.)

Timeline for d1gypa2: