Lineage for d7k41a3 (7k41 A:437-593)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351212Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2351213Protein automated matches [254554] (3 species)
    not a true protein
  7. 2351230Species Escherichia coli [TaxId:83333] [399129] (1 PDB entry)
  8. 2351231Domain d7k41a3: 7k41 A:437-593 [399130]
    Other proteins in same PDB: d7k41a1, d7k41a2
    automated match to d2choa1
    complexed with act, edo, vua

Details for d7k41a3

PDB Entry: 7k41 (more details), 2 Å

PDB Description: bacterial o-glcnacase (oga) with compound
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d7k41a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k41a3 a.246.1.0 (A:437-593) automated matches {Escherichia coli [TaxId: 83333]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymph

SCOPe Domain Coordinates for d7k41a3:

Click to download the PDB-style file with coordinates for d7k41a3.
(The format of our PDB-style files is described here.)

Timeline for d7k41a3: