| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
| Protein automated matches [254554] (3 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [399129] (1 PDB entry) |
| Domain d7k41a3: 7k41 A:437-593 [399130] Other proteins in same PDB: d7k41a1, d7k41a2 automated match to d2choa1 complexed with act, edo, vua |
PDB Entry: 7k41 (more details), 2 Å
SCOPe Domain Sequences for d7k41a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k41a3 a.246.1.0 (A:437-593) automated matches {Escherichia coli [TaxId: 83333]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymph
Timeline for d7k41a3: