| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
| Protein automated matches [227062] (5 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [399125] (1 PDB entry) |
| Domain d7k41a1: 7k41 A:2-126 [399126] Other proteins in same PDB: d7k41a2, d7k41a3 automated match to d2vvna3 complexed with act, edo, vua |
PDB Entry: 7k41 (more details), 2 Å
SCOPe Domain Sequences for d7k41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k41a1 d.92.2.0 (A:2-126) automated matches {Escherichia coli [TaxId: 83333]}
nvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisige
kgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpevei
kdyps
Timeline for d7k41a1: