Lineage for d7k41a1 (7k41 A:2-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965198Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2965199Protein automated matches [227062] (5 species)
    not a true protein
  7. 2965215Species Escherichia coli [TaxId:83333] [399125] (1 PDB entry)
  8. 2965216Domain d7k41a1: 7k41 A:2-126 [399126]
    Other proteins in same PDB: d7k41a2, d7k41a3
    automated match to d2vvna3
    complexed with act, edo, vua

Details for d7k41a1

PDB Entry: 7k41 (more details), 2 Å

PDB Description: bacterial o-glcnacase (oga) with compound
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d7k41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k41a1 d.92.2.0 (A:2-126) automated matches {Escherichia coli [TaxId: 83333]}
nvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisige
kgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpevei
kdyps

SCOPe Domain Coordinates for d7k41a1:

Click to download the PDB-style file with coordinates for d7k41a1.
(The format of our PDB-style files is described here.)

Timeline for d7k41a1: