Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) |
Species Archaeon Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry) |
Domain d1cf2p2: 1cf2 P:139-303 [39911] Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1 |
PDB Entry: 1cf2 (more details), 2.1 Å
SCOP Domain Sequences for d1cf2p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf2p2 d.81.1.1 (P:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus} scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd
Timeline for d1cf2p2: