SCOP 1.59: Domain d1cf2o2: 1cf2 O:139-303

Lineage for d1cf2o2 (1cf2 O:139-303)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
Family d.81.1.1: GAPDH-like [55348] (2 proteins)
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
Species Archaeon Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry)
Domain d1cf2o2: 1cf2 O:139-303 [39909]
Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1

Details for d1cf2o2

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus}
scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv
ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst
aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd

SCOP Domain Coordinates for d1cf2o2:

Click to download the PDB-style file with coordinates for d1cf2o2.
(The format of our PDB-style files is described here.)

Timeline for d1cf2o2: