Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry) |
Domain d1b7gq2: 1b7g Q:139-300 [39908] Other proteins in same PDB: d1b7go1, d1b7gq1 CASP3 complexed with so4; mutant |
PDB Entry: 1b7g (more details), 2.05 Å
SCOP Domain Sequences for d1b7gq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7gq2 d.81.1.1 (Q:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq
Timeline for d1b7gq2: