Lineage for d1b7gq2 (1b7g Q:139-300)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 727962Species Archaeon Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry)
  8. 727964Domain d1b7gq2: 1b7g Q:139-300 [39908]
    Other proteins in same PDB: d1b7go1, d1b7gq1
    CASP3
    complexed with so4; mutant

Details for d1b7gq2

PDB Entry: 1b7g (more details), 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase
PDB Compounds: (Q:) protein (glyceraldehyde 3-phosphate dehydrogenase)

SCOP Domain Sequences for d1b7gq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7gq2 d.81.1.1 (Q:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn
svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat
aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq

SCOP Domain Coordinates for d1b7gq2:

Click to download the PDB-style file with coordinates for d1b7gq2.
(The format of our PDB-style files is described here.)

Timeline for d1b7gq2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7gq1