Lineage for d1b7gq2 (1b7g Q:139-300)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33857Species Sulfolobus solfataricus [TaxId:2287] [55354] (1 PDB entry)
  8. 33859Domain d1b7gq2: 1b7g Q:139-300 [39908]
    Other proteins in same PDB: d1b7go1, d1b7gq1

Details for d1b7gq2

PDB Entry: 1b7g (more details), 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1b7gq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7gq2 d.81.1.1 (Q:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Sulfolobus solfataricus}
cnttallrtictvnkvskvekvrativrraadqkevkkgpinslvpdpatvpshhakdvn
svirnldiatmaviapttlmhmhfinitlkdkvekkdilsvlentprivlisskydaeat
aelvevardlkrdrndipevmifsdsiyvkddevmlmyavhq

SCOP Domain Coordinates for d1b7gq2:

Click to download the PDB-style file with coordinates for d1b7gq2.
(The format of our PDB-style files is described here.)

Timeline for d1b7gq2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7gq1