SCOP 1.69: Domain d1hdgq2: 1hdg Q:149-312

Lineage for d1hdgq2 (1hdg Q:149-312)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (4 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)

7. Species Thermotoga maritima [TaxId:243274] [55353] (1 PDB entry)

8. Domain d1hdgq2: 1hdg Q:149-312 [39906]
   Other proteins in same PDB: d1hdgo1, d1hdgq1

Details for d1hdgq2

PDB Entry: 1hdg, 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution

SCOP Domain Sequences for d1hdgq2:

Sequence; same for both SEQRES and ATOM records:

>d1hdgq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima}
cttnsiapivkvlhekfgivsgmlttvhsytndqrvldlphkdlrraraaavniiptttg
aakavalvvpevkgkldgmairvptpdgsitdltvlvekettveevnavmkeategrlkg
iigyndepivssdiigttfsgifdatitnviggklvkvaswyd

Timeline for d1hdgq2:

• d1hdgq2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdgq2 appears in SCOP 1.67
  
• d1hdgq2 appears in SCOP 1.71
  
• d1hdgq2 appears in the current release, SCOPe 2.08